Recombinant Human C-C chemokine receptor type 5 (CCR5)-VLPs (Active)

SKU: orb2280241

Description

This Recombinant Human C-C chemokine receptor type 5 (CCR5)-VLPs (Active) spans the amino acid sequence from region 1-352aa. Purity: The purity information is not available for VLPs proteins.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR5 at 10 μg/mL can bind Anti-CCR5 recombinant antibody. The EC50 is 1.099-1.287 ng/mL. The VLPs is negative control.
• Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
• Expression Region: 1-352aa
• Protein Length: Full Length
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 42.3 kDa
• Purity: The purity information is not available for VLPs proteins.
• Protein Sequence: MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

C-C CKR-5;CC-CKR-5;CCR-5;CCR5;CHEMR13;HIV-1 fusion coreceptor;CD antigen CD195

Quick Database Links

UniProt

P51681