You have no items in your shopping cart.
Recombinant CXCL10 (C-X-C motif chemokine 10), Mouse, AF
SKU: orb1178993
Description
Images & Validation
−
| Tested Applications | ELISA |
|---|
Key Properties
−| Source | Escherichia coli |
|---|---|
| Biological Activity | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <0.2 μg/mL. |
| Reactivity | Mouse |
| Tag | His-tag at the N-terminus |
| Protein Sequence | IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP with polyhistidine tag at the N-terminus. |
| Purity | >98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Endotoxins | <0.1 EU per 1 μg of the protein by the LAL method. |
Storage & Handling
−| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Disclaimer | For research use only |
Alternative Names
−IP-10, Gamma-Interferon Inducible Protein 10, Crg-2
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Recombinant CXCL10 (C-X-C motif chemokine 10), Mouse, AF (orb1178993)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days