You have no items in your shopping cart.
Recombinant Chlamydia pneumoniae Large cysteine-rich periplasmic protein OmcB (omcB), partial
SKU: orb2659569
Featured
Description
Research Area
Pharmacology & Drug Discovery
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Chlamydia pneumoniae (Chlamydophila pneumoniae) |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 41-196aa |
| Protein Length | Partial |
| MW | 24.2 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGC |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Large-CRP;60 kDa cysteine-rich OMP;60 kDa CRP;60 kDa outer membrane protein;Cysteine-rich outer membrane protein
Similar Products
−Recombinant Chlamydia pneumoniae Large cysteine-rich periplasmic protein OmcB (omcB), partial [orb2658257]
Greater than 85% as determined by SDS-PAGE.
22.9 kDa
Baculovirus
1 mg, 100 μg, 20 μgRecombinant Chlamydia pneumoniae Large cysteine-rich periplasmic protein OmcB(omcB), partial [orb2658259]
Greater than 85% as determined by SDS-PAGE.
20.1 kDa
Baculovirus
1 mg, 100 μg, 20 μgRecombinant Chlamydia pneumoniae Large cysteine-rich periplasmic protein OmcB(omcB),partial [orb1649752]
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide



