Recombinant Bovine Fibroblast growth factor 1 (FGF1)

SKU: orb2658561

Description

This Recombinant Bovine Fibroblast growth factor 1 (FGF1) spans the amino acid sequence from region 2-155aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Cardiovascular Research; Stem Cell & Developmental Biology

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  Read more...

Key Properties

• Source: E.coli
• Biological Origin: Bos taurus (Bovine)
• Tag: N-terminal 6xHis-tagged
• Expression Region: 2-155aa
• Protein Length: Full Length of Mature Protein
• MW: 21.4 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: AEGETTTFTALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQLCAESIGEVYIKSTETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKHWFVGLKKNGRSKLGPRTHFGQKAILFLPLPVSSD

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FGF-1;Acidic eye-derived growth factor II;EDGF II;Acidic fibroblast growth factor;aFGF;Endothelial cell growth factor;ECGF;Heparin-binding growth factor 1;HBGF-1;Prostatropin

Quick Database Links

UniProt

P03968