You have no items in your shopping cart.
Featured
Description
Research Area
Microbiology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Bovine coronavirus (strain OK-0514) (BCoV) (BCV) |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 1-208aa |
| Protein Length | Full Length |
| MW | 25.3 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MASLSGPISPTNLEMFKPGVEELNPSKLLLLSNHQEGMLYPTILGSLELLSFKRERSLNLQRDKVCLLHQESQLLKLRGTGTDTTDVPLKQPMATSVNCCHDGIFTILEQDRMPKTSMAPTLTESSGSLVTRLMSIPRLTFSIGTQVAMRLFRLGFRLARYSLRVTILKAQEGLLLIPDLLHAHPVEPLVQDRAVEPILAIEPLPLV |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Accessory protein N2, N internal ORF protein, IORF, Protein in nucleocapsid ORF
Similar Products
−Recombinant Bovine coronavirus Protein I (N) [orb1096631]
Greater than 90% as determined by SDS-PAGE.
25.4 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Bovine coronavirus Protein I (N) [orb1096632]
Greater than 85% as determined by SDS-PAGE.
24.4 kDa
E.coli
20 μg, 1 mg, 100 μgRecombinant Bovine coronavirus Protein I (N) [orb1096633]
Greater than 85% as determined by SDS-PAGE.
24.4 kDa
E.coli
100 μg, 1 mg, 20 μgRecombinant Bovine coronavirus Protein I (N) [orb1096634]
Greater than 85% as determined by SDS-PAGE.
24.0 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Bovine coronavirus Protein I (N) [orb1096639]
Greater than 85% as determined by SDS-PAGE.
25.5 kDa
E.coli
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide





