You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330130 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RBMS1 |
Target | RBMS1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RBMS1 |
Protein Sequence | Synthetic peptide located within the following region: TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ |
UniProt ID | P29558 |
MW | 44kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti YC1 antibody, anti MSSP antibody, anti SCR2 a Read more... |
Note | For research use only |
NCBI | NP_002888 |
Positive control (+): HeLa Cell Lysate (HL), Negative control (-): A549 Cell Lysate (N03), Antibody concentration: 3 ug/mL.
Rabbit Anti-RBMS1 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-RBMS1 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.
ELISA, IF, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |