RBMS1 Rabbit Polyclonal Antibody

• Catalog Number: orb330131
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RBMS1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBMS1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44kDa
• Target: RBMS1
• UniProt ID: P29558
• Protein Sequence: Synthetic peptide located within the following region: GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTT
• NCBI: NP_002888
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti YC1 antibody, anti MSSP antibody, anti SCR2 a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-RBMS1 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, RBMS1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.