Cart summary

You have no items in your shopping cart.

RBBP9 Rabbit Polyclonal Antibody (FITC)

RBBP9 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2134519

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2134519
CategoryAntibodies
DescriptionRBBP9 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RBBP9
Protein SequenceSynthetic peptide located within the following region: MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA
UniProt IDO75884
MW21kDa
Tested applicationsIF, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesBOG, RBBP10
NoteFor research use only
NCBINP_006597