RBBP9 Rabbit Polyclonal Antibody

• Catalog Number: orb329790
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RBBP9
• Target: RBBP9
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP9
• Protein Sequence: Synthetic peptide located within the following region: MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA
• UniProt ID: O75884
• MW: 21kDa
• Tested applications: ICC, IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti BOG antibody, anti MGC9236 antibody, anti RBB
• Research Area: Epigenetics & Chromatin, Molecular Biology
• Note: For research use only
• NCBI: NP_006597

WB Suggested Anti-HNRNPA0 Antibody, Titration: 1.25 ug/mL, Positive Control: HepG2 Whole Cell.

WB Suggested Anti-RBBP9 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: THP-1 cell lysate.