You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Rat Prss2 protein
Catalog Number: orb605373
| Catalog Number | orb605373 |
|---|---|
| Category | Proteins |
| Description | Recombinant Rat Anionic trypsin-2(Prss2) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P00763 |
| MW | 25.3 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Rattus norvegicus (Rat) |
| Expression Region | 24-246aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Anionic trypsin II (Pretrypsinogen II) (Serine pro Read more... |
| Note | For research use only |
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Rattus norvegicus (Rat) Prss2.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Rattus norvegicus (Rat) Prss2.
