RASGRP1 Rabbit Polyclonal Antibody

• Catalog Number: orb585769
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RASGRP1
• Target: RASGRP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: LGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKR
• UniProt ID: O95267
• MW: 90kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: IMD64, RASGRP, CALDAG-GEFI, CALDAG-GEFII
• Research Area: Cell Biology, Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_005730

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml.

WB Suggested Anti-RASGRP1 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell. RASGRP1 is supported by BioGPS gene expression data to be expressed in Jurkat.