You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Rabies virus Glycoprotein
Catalog Number: orb246532
| Catalog Number | orb246532 |
|---|---|
| Category | Proteins |
| Description | Recombinant Rabies virus Glycoprotein G |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 65.5 kDa |
| UniProt ID | P03524 |
| Protein Sequence | KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Rabies virus (strain ERA) (RABV) |
| Expression Region | 20-459aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Rabies virus Glycoprotein Read more... |
| Note | For research use only |
| Application notes | This is His-SUMO-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rabies virus (strain ERA) (RABV) G.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rabies virus (strain ERA) (RABV) G.
- Item 1 of 3
Viral Glycoprotein protein [orb419329]
Greater than 90% as determined by SDS-PAGE.
69.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
Yeast G protein [orb246838]
Greater than 90% as determined by SDS-PAGE.
51.4 kDa
Yeast
20 μg, 100 μg, 1 mg 
- Item 1 of 1
Glycoprotein G protein [orb246535]
Greater than 90% as determined by SDS-PAGE.
65.4 kDa
E.coli
20 μg, 1 mg, 100 μg - Item 1 of 1
Recombinant Rabies virus Glycoprotein G (G), partial [orb1881891]
Greater than 85% as determined by SDS-PAGE.
56.6 kDa
E.coli
20 μg, 100 μg, 1 mg
