Rab5b Antibody

• Catalog Number: orb11629
• Category: Antibodies
• Description: Goat polyclonal antibody to mouse Rab5b. Rab5b belongs to the small GTPase superfamily, Rab family. Rab5b is an Early Endosome Marker and functions as a key regulator of vesicular trafficking during early endocytosis.
• Target: RAB5B, member RAS oncogene family
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Purification: Epitope affinity purified
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5b produced in E. coli.. Antigen Sequence: VKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
• Tested applications: IF, IHC-Fr, IHC-P, WB
• Dilution range: WB:1:250-1:1,000, IF:1:50-1:250, IHC-P:1:100-1:500, IHC-F:1:100-1:500
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RAB5B, RAS-associated protein RAB5B, ras-related p
• Note: For research use only

Western blot analysis of transfected 293HEK cell lysate using Rab5b antibody

Confocal immunofluorescence analysis of B6-RPE07 cells using Rab5b antibody