You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583190 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RAB5B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RAB5B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24kDa |
Target | RAB5B |
UniProt ID | P61020 |
Protein Sequence | Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE |
NCBI | NP_002859 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample type: zebrafish gut epithelial cells, Green: primary, Red: actin, Blue: DAPI, Primary dilution: 1:5000, Secondary dilution: 1:300.
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
WB Suggested Anti-RAB5B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |