RAB5B Rabbit Polyclonal Antibody

• Catalog Number: orb583190
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAB5B
• Target: RAB5B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Zebrafish
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB5B
• Protein Sequence: Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE
• UniProt ID: P61020
• MW: 24kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Research Area: Immunology & Inflammation, Signal Transduction
• Note: For research use only
• NCBI: NP_002859

Sample type: zebrafish gut epithelial cells, Green: primary, Red: actin, Blue: DAPI, Primary dilution: 1:5000, Secondary dilution: 1:300.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

WB Suggested Anti-RAB5B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.