Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Rab31 Antibody

SKU: orb334989

Description

RAB31 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. This protein is required for the normal function and integrity of the Golgi apparatus and the trans-Golgi network. Moreover, Rab31 plays a role in the transport from Golgi to endosomes (M6PR), internalization from cell membrane into endosomes (EGFR), insulin-stimulated translocation to cell membrane (GLUT4), etc.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:250-1:2,000
ReactivityBovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 95 aa to the C-terminus of mouse Rab31 produced in E. coli. Antigen Sequence: KKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLGPQENGNSGGIKLGNQSLQASRRCC
TargetRAB31, member RAS oncogene family
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Rab22b, Ras-Related Protein Rab-31 antibody.

Similar Products

  • RAB31 Rabbit Polyclonal Antibody [orb585186]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Rab 31 rabbit pAb Antibody [orb767459]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Recombinant

    Unconjugated

    100 μl, 50 μl
  • RAB31 Antibody [orb1535890]

    ICC,  IF,  IHC,  IHC-P,  WB

    Bovine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl
  • RAB31 specific Rabbit Polyclonal Antibody [orb395496]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • RAB31 Rabbit Polyclonal Antibody [orb312851]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Feline, Gallus, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rab31 Antibody

Western blot analysis of staining of RPE primary cell culture using Rab31 antibody

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Rab31 Antibody (orb334989)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 280.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry