Rab31 Antibody

• Catalog Number: orb334989
• Category: Antibodies
• Description: RAB31 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. This protein is required for the normal function and integrity of the Golgi apparatus and the trans-Golgi network. Moreover, Rab31 plays a role in the transport from Golgi to endosomes (M6PR), internalization from cell membrane into endosomes (EGFR), insulin-stimulated translocation to cell membrane (GLUT4), etc.
• Target: RAB31, member RAS oncogene family
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Purification: Epitope affinity purified
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 95 aa to the C-terminus of mouse Rab31 produced in E. coli.. Antigen Sequence: KKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLGPQENGNSGGIKLGNQSLQASRRCC
• Tested applications: WB
• Dilution range: WB:1:250-1:2,000
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Rab22b, Ras-Related Protein Rab-31 antibody.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of staining of RPE primary cell culture using Rab31 antibody