Rab31 Antibody

SKU: orb334989

Description

RAB31 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. This protein is required for the normal function and integrity of the Golgi apparatus and the trans-Golgi network. Moreover, Rab31 plays a role in the transport from Golgi to endosomes (M6PR), internalization from cell membrane into endosomes (EGFR), insulin-stimulated translocation to cell membrane (GLUT4), etc.

Images & Validation

• Tested Applications: WB
• Dilution range: WB:1:250-1:2,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 95 aa to the C-terminus of mouse Rab31 produced in E. coli.. Antigen Sequence: KKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLGPQENGNSGGIKLGNQSLQASRRCC
• Target: RAB31, member RAS oncogene family
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

Rab22b, Ras-Related Protein Rab-31 antibody.

Western blot analysis of staining of RPE primary cell culture using Rab31 antibody

Quick Database Links

Gene Symbol

RAB31, member RAS oncogene family