RAB31 Rabbit Polyclonal Antibody

SKU: orb585186

Description

Rabbit polyclonal antibody to RAB31

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: RAB31
• Protein Sequence: Synthetic peptide located within the following region: EVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGN
• Molecular Weight: 21kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Rab22B

Positive control (+): Human Brain (BR), Negative control (-): Human Liver (LI), Antibody concentration: 1 ug/ml.

Lane 1: GFP-Rab5 transfected cos cells, Lane 2: GFP-Rab31 transfected cos cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: RAB31.

WB Suggested Anti-RAB31 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.

Quick Database Links

Gene Symbol

RAB31

UniProt

Q53EY4

RefSeq (Protein):NP_006859