Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

(Pyr3)-Amyloid β-Protein (3-42) (TFA)

SKU: orb2693159

Description

(Pyr3)-Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.

Research Area

Neuroscience; Immunology & Inflammation

Images & Validation

Key Properties

TargetAmyloid-β
MW4309.86
Purity≥95%
FormulaC196H299N53O55S.xC2HF3O2
Protein Sequence{Pyr}-FRHDSGYVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Storage & Handling

Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

(Pyr3)-Amyloid β-Protein (3-42) (TFA) (orb2693159)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet