Cart summary

You have no items in your shopping cart.

[Pyr11]-Amyloid β-Protein (11-40)

SKU: orb2693157

Description

(Pyr11)-Amyloid β-Protein (11-40) (A beta 11pE-40) is a peptide. (Pyr11)-Amyloid β-Protein (11-40) can be used for the research of Alzheimer's disease.

Images & Validation

Key Properties

TargetAmyloid-β
Molecular Weight3133.71
Protein Sequence{Pyr}-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Purity≥95%

Storage & Handling

Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

[Pyr11]-Amyloid β-Protein (11-40) (orb2693157)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 mg
$ 580.00
10 mg
$ 950.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry