PYCR2 Rabbit Polyclonal Antibody

• Catalog Number: orb582556
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PYCR2
• Target: PYCR2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PYCR2
• Protein Sequence: Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
• UniProt ID: Q96C36
• MW: 34 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HLD10, P5CR2
• Note: For research use only
• NCBI: NP_037460

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.8 ug/ml of the antibody was used in this experiment.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

PYCR2 antibody - C-terminal region (orb582556) validated by WB using 293T cells lysate at 1 ug/ml.

WB Suggested Anti-PYCR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.