PYCR2 Rabbit Polyclonal Antibody

• Catalog Number: orb582555
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PYCR2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: PYCR2
• UniProt ID: Q96C36
• Protein Sequence: Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE
• NCBI: NP_037460
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HLD10, P5CR2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1. 10 ug human fibroblast lysate, 2. 10 ug PYCR1 KO human fibroblast lysate, Primary Antibody dilution: 1:300, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: PYCR2.

PYCR2 antibody - middle region (orb582555) validated by WB using 293T cells lysate at 1 ug/ml.

Sample Type: 1. WT human fibroblast 2. PYCR1 KO human fibroblast, Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: PYCR2: Green DAPI:Blue, Gene Name: PYCR2.

WB Suggested Anti-PYCR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.