Pthlh Rabbit Polyclonal Antibody

• Catalog Number: orb574867
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Pthlh
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16kDa
• Target: Pthlh
• UniProt ID: P22858
• Protein Sequence: Synthetic peptide located within the following region: EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK
• NCBI: NP_032996
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Pt, PLP, PTH-l, Pthrp, PTH-like
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Lung tissue at an antibody concentration of 5 ug/ml using anti-Pthlh antibody (orb574867).

WB Suggested Anti-Pthlh Antibody Titration: 1 ug/ml, Positive Control: Mouse Brain lysate.