You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574866 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PTHLH |
| Target | PTHLH |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PTHLH |
| Protein Sequence | Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
| UniProt ID | P12272 |
| MW | 20kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | HHM, PLP, BDE2, PTHR, PTHRP |
| Research Area | Epigenetics & Chromatin, Pharmacology & Drug Disco Read more... |
| Note | For research use only |
| NCBI | NP_002811 |

IHC Information:Rabbit Anti-PTHLH Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Primary antibody dilution: 1:1000, Secondary antibody: Goat anti-rabbit HRP, Secondary antibody dilution: 1:2000.

Rabbit Anti-PTHLH Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of collecting tubule and renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-PTHLH Antibody Titration: 2.0 ug/ml, Positive Control: HepG2 cell lysate.
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
HRP |
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review