PTHLH Rabbit Polyclonal Antibody

• Catalog Number: orb574866
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PTHLH
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTHLH
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 20kDa
• Target: PTHLH
• UniProt ID: P12272
• Protein Sequence: Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
• NCBI: NP_002811
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HHM, PLP, BDE2, PTHR, PTHRP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

IHC Information:Rabbit Anti-PTHLH Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Primary antibody dilution: 1:1000, Secondary antibody: Goat anti-rabbit HRP, Secondary antibody dilution: 1:2000.

Rabbit Anti-PTHLH Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of collecting tubule and renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-PTHLH Antibody Titration: 2.0 ug/ml, Positive Control: HepG2 cell lysate.