You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
PTGS1 Rabbit Polyclonal Antibody
Catalog Number: orb578237
| Catalog Number | orb578237 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PTGS1 |
| Target | PTGS1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PTGS1 |
| Protein Sequence | Synthetic peptide located within the following region: LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWE |
| UniProt ID | P23219 |
| MW | 69kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | COX1, COX3, PHS1, PCOX1, PES-1, PGHS1, PTGHS, PGG/ Read more... |
| Note | For research use only |
| NCBI | NP_000953 |
Rabbit Anti-PTGS1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-PTGS1 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.
- Item 1 of 2
Cyclooxygenase 1 Rabbit Polyclonal Antibody [orb10448]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Porcine, Rat, Sheep
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 3
- Item 1 of 3
- Item 1 of 3
