PTGS1 Rabbit Polyclonal Antibody

• Catalog Number: orb578238
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PTGS1
• Target: PTGS1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTGS1
• Protein Sequence: Synthetic peptide located within the following region: GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE
• UniProt ID: P23219
• MW: 66kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: COX1, COX3, PHS1, PCOX1, PES-1, PGHS1, PTGHS, PGG/
• Note: For research use only
• NCBI: NP_000953

PTGS1 antibody - middle region (orb578238), Catalog Number: orb578238, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nucleus in Human Pineal Tissue, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PTGS1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.