You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574213 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PSMD14 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD14 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | PSMD14 |
UniProt ID | O00487 |
Protein Sequence | Synthetic peptide located within the following region: MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVP |
NCBI | NP_005796 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PAD1, POH1, RPN11 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Rabbit Anti-PSMD14 antibody, Catalog Number: orb574213, Paraffin Embedded Tissue: Human Lung cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-PSMD14 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate, PSMD14 is supported by BioGPS gene expression data to be expressed in HepG2.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |