Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PSMD14 Rabbit Polyclonal Antibody

SKU: orb574212

Description

PSMD14 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PSMD14. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human PSMD14. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PSMD14
TargetPSMD14
Protein SequenceSynthetic peptide located within the following region: EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Molecular Weight35kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PAD1, POH1, RPN11

Similar Products

  • POH1/PSMD14 Rabbit Polyclonal Antibody [orb1728099]

    ELISA,  FC,  ICC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • PSMD14 Rabbit Polyclonal Antibody [orb312510]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PSMD14 Rabbit Polyclonal Antibody [orb574213]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PSMD14 Rabbit Polyclonal Antibody [orb630312]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • PSMD14 Rabbit Polyclonal Antibody [orb411820]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PSMD14 Rabbit Polyclonal Antibody

Lanes: 1. 100 ug HeLa cell lysate, 2. 100 ug mouse liver cytosolic extract 3. 1.5 ug human 26S Proteasome, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit AP, Secondary Antibody dilution: 1:10000, Gene Name: PSMD14.

PSMD14 Rabbit Polyclonal Antibody

Rabbit Anti-PSMD14 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

PSMD14 Rabbit Polyclonal Antibody

WB Suggested Anti-PSMD14 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, PSMD14 is supported by BioGPS gene expression data to be expressed in HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005796

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PSMD14 Rabbit Polyclonal Antibody (orb574212)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry