PSMD14 Rabbit Polyclonal Antibody

• Catalog Number: orb574212
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSMD14
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSMD14
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: PSMD14
• UniProt ID: O00487
• Protein Sequence: Synthetic peptide located within the following region: EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
• NCBI: NP_005796
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PAD1, POH1, RPN11
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1. 100 ug HeLa cell lysate, 2. 100 ug mouse liver cytosolic extract 3. 1.5 ug human 26S Proteasome, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit AP, Secondary Antibody dilution: 1:10000, Gene Name: PSMD14.

Rabbit Anti-PSMD14 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-PSMD14 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, PSMD14 is supported by BioGPS gene expression data to be expressed in HepG2.