Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PSMA2 Rabbit Polyclonal Antibody

SKU: orb583168

Description

PSMA2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PSMA2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Protein Biochemistry

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PSMA2
TargetPSMA2
Protein SequenceSynthetic peptide located within the following region: VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV
Molecular Weight26kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MU, HC3, PSC2, PMSA2

Similar Products

  • PSMA2 Rabbit Polyclonal Antibody [orb630288]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • PSMA2 Rabbit Polyclonal Antibody [orb340841]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • Psma2 Rabbit Polyclonal Antibody [orb583169]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Sheep, Zebrafish

    Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Proteasome 20S alpha 2/PSMA2 Rabbit Polyclonal Antibody [orb381090]

    WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Proteasome 20S alpha 2/PSMA2 Rabbit Polyclonal Antibody (Fluoro647) [orb3079361]

    Human, Rat

    Rabbit

    Polyclonal

    Fluoro647

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PSMA2 Rabbit Polyclonal Antibody

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in HEK293T.

PSMA2 Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PSMA2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

PSMA2 Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. PSMA2 is supported by BioGPS gene expression data to be expressed in HeLa.

PSMA2 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

PSMA2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

PSMA2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

PSMA2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

PSMA2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

PSMA2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

PSMA2 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in Jurkat.

PSMA2 Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in MCF7.

PSMA2 Rabbit Polyclonal Antibody

WB Suggested Anti-PSMA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002778

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PSMA2 Rabbit Polyclonal Antibody (orb583168)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry