Psma2 Rabbit Polyclonal Antibody

SKU: orb583169

Description

Psma2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Psma2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Psma2. This antibody reacts with Rat samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Psma2
• Target: Psma2
• Protein Sequence: Synthetic peptide located within the following region: TQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGK
• Molecular Weight: 25kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Sample Type: Rat Lung lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

Psma2

UniProt

P17220

RefSeq (Protein):NP_058975