You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb704793 |
---|---|
Category | Proteins |
Description | Recombinant Vaccinia virus Protein B5(PS/HR),partial |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 33 kDa |
UniProt ID | Q01227 |
Protein Sequence | YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH |
Protein Length | Partial |
Source | Baculovirus |
Expression System | Expression Region: 18-279aa. Protein Length: Partial |
Expression Region | 18-279aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Plaque-size/host range protein Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
10.6 kDa | |
Yeast |
Greater than 85% as determined by SDS-PAGE. | |
14.1 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
33.0 kDa | |
Baculovirus |
Greater than 85% as determined by SDS-PAGE. | |
36.5 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
31.1 kDa | |
Yeast |
Filter by Rating