You have no items in your shopping cart.
PSG5 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PSG5 |
| Target | PSG5 |
| Protein Sequence | Synthetic peptide located within the following region: SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI |
| Molecular Weight | 38 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PSG5 Rabbit Polyclonal Antibody [orb578324]
WB
Canine, Equine, Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlPSG5 Rabbit Polyclonal Antibody (FITC) [orb2122776]
WB
Canine, Equine, Human, Mouse, Rat
Rabbit
Polyclonal
FITC
100 μlPSG5 Rabbit Polyclonal Antibody (Biotin) [orb2122777]
WB
Canine, Equine, Human, Mouse, Rat
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein is processed to 34 kDa from precursor form.

Positive control (+): MCF7 (N10), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.

Rabbit Anti-PSG5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Placenta, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PSG5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Spleen.
Documents Download
Request a Document
PSG5 Rabbit Polyclonal Antibody (orb578325)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
