PSG5 Rabbit Polyclonal Antibody

SKU: orb578324

Description

Rabbit polyclonal antibody to PSG5

Research Area

Disease Biomarkers, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSG5
• Target: PSG5
• Protein Sequence: Synthetic peptide located within the following region: QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY
• Molecular Weight: 37kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PSG, FL-NCA-3

WB Suggested Anti-PSG5 Antibody Titration: 2.5 ug/ml, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

PSG5

UniProt

Q15238

RefSeq (Protein):NP_002772