PSEN1 Rabbit Polyclonal Antibody

• Catalog Number: orb579084
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSEN1
• Target: PSEN1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSEN1
• Protein Sequence: Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY
• UniProt ID: P49768
• MW: 53kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AD3, FAD, PS1, PS-1, S182, ACNINV3
• Note: For research use only
• NCBI: NP_000012

Brain, cerebellum

Sample Tissue: Rat Liver, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-PSEN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: OVCAR-3 cell lysate. PSEN1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.