Protein Kinase C (530-558)

SKU: orb2694932

Description

Protein Kinase C (530-558), a peptide fragment of protein kinase C (PKC), is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption.

Research Area

Signal Transduction

Images & Validation

−

Key Properties

−

Target	PKC
CAS Number	122613-29-0
MW	3354.7
Purity	≥95%
Formula	C₁₄₈H₂₂₀N₃₄O₅₁S₂
Protein Sequence	LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

PKC

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols