Pros1 Rabbit Polyclonal Antibody

SKU: orb582999

Description

Rabbit polyclonal antibody to Pros1

Research Area

Cardiovascular Research

Images & Validation

• Tested Applications: WB
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Target: Pros1
• Protein Sequence: Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS
• Molecular Weight: 75 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Pros

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 60 kDa isoform and the protein is also processed to a mature 71 kDa form. The protein may be modified by carboxylation and glycosylation.

WB Suggested Anti-Pros1 Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Muscle.

Quick Database Links

Gene Symbol

Pros1

UniProt

Q08761

RefSeq (Protein):NP_112348