PROS1 Rabbit Polyclonal Antibody

• Catalog Number: orb582998
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PROS1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PROS1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71kDa
• Target: PROS1
• UniProt ID: P07225
• Protein Sequence: Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
• NCBI: NP_000304
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PSA, PROS, PS21, PS22, PS23, PS24, PS25, THPH5, TH
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Immunohistochemistry with Liver tissue at an antibody concentration of 5 ug/ml using anti-PROS1 antibody (orb582998).

WB Suggested Anti-PROS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.