You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb582998 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PROS1 |
| Target | PROS1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PROS1 |
| Protein Sequence | Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL |
| UniProt ID | P07225 |
| MW | 71kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | PSA, PROS, PS21, PS22, PS23, PS24, PS25, THPH5, TH Read more... |
| Research Area | Cell Biology, Signal Transduction |
| Note | For research use only |
| NCBI | NP_000304 |

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Immunohistochemistry with Liver tissue at an antibody concentration of 5 ug/ml using anti-PROS1 antibody (orb582998).

WB Suggested Anti-PROS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Human, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Equine, Human, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Human, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review