Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Currently Filtering By

Category : Proteins and Peptides

Clear All Items
On Promotion
Elisa Kits Promotion 0Free Kit PromotionProducts on Sale 0SALE
Category
Proteins and Peptides 2046
Species Host
E. coli 4
Tested Applications
ELISA 332WB 322SDS-PAGE 224MS 85Blocking 80HPLC 11Cell Culture 10FA 8CLIA 1EIA 1LF 1
Reactivity
Human 215Mouse 114Rat 58Monkey 25Canine 13Porcine 11Bovine 9Zebrafish 7Rabbit 4Sheep 3Gallus 2
Conjugation
Unconjugated 127Biotin 3
Matched Antibody
Yes 0No 2046
Biologically Active
Yes 195
Featured Product
Yes 276
Has Publications
Yes 0No 2046

Search results for: 'cytokine'

Items 241 - 250 of 2046

Show
per page
  • FeaturedFeatured Product
    1. Human Interferon gamma protein
    Item 1 of 1

    Human Interferon gamma protein [orb604014]

    This product can be custom made
    FeaturedFeatured Product

    Greater than 90% as determined by SDS-PAGE.

    12.6 kDa

    E.coli

    Homo sapiens (Human)

    22-98aa

    Full Length of Mature Protein

    N-terminal 6xHis-tagged

    1 mg, 100 μg, 20 μg
  • FeaturedFeatured Product
    1. Human CXCL13 protein
    Item 1 of 1

    Human CXCL13 protein [orb604018]

    This product can be custom made
    FeaturedFeatured Product

    Greater than 90% as determined by SDS-PAGE.

    12.8 kDa

    E.coli

    Homo sapiens (Human)

    23-95aa

    Partial

    N-terminal 6xHis-tagged

    1 mg, 100 μg, 20 μg
  • FeaturedFeatured Product
    1. Human CXCL5 protein
    Item 1 of 1

    Human CXCL5 protein [orb604021]

    This product can be custom made
    FeaturedFeatured Product

    Greater than 90% as determined by SDS-PAGE.

    34.9 kDa

    E.coli

    Homo sapiens (Human)

    37-110aa

    Partial

    N-terminal GST-tagged

    1 mg, 100 μg, 20 μg
  • FeaturedFeatured Product
    1. Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial
    Item 1 of 1

    Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial [orb1096081]

    This product can be custom made
    FeaturedFeatured Product

    Greater than 85% as determined by SDS-PAGE.

    27.5 kDa

    Mammalian cell

    Homo sapiens (Human)

    63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG)

    Partial of Isoform2

    N-terminal 10xHis-tagged

    1 mg, 100 μg, 20 μg
  • FeaturedFeatured Product
    ActiveActive
    1. Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial (Active)
    Item 1 of 1

    Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial (Active) [orb1096082]

    This product can be custom made
    FeaturedFeatured Product
    ActiveActive

    Greater than 95% as determined by SDS-PAGE.

    22.7 kDa

    Mammalian cell

    Homo sapiens (Human)

    63-244aa

    Partial of Isoform 2

    N-terminal 6xHis-tagged

    1 mg, 100 μg, 20 μg
  • FeaturedFeatured Product
    1. Recombinant Dog C-C motif chemokine 17 (CCL17)
    Item 1 of 1

    Recombinant Dog C-C motif chemokine 17 (CCL17) [orb1096215]

    This product can be custom made
    FeaturedFeatured Product

    Greater than 85% as determined by SDS-PAGE.

    23.9 kDa

    E.coli

    Canis lupus familiaris (Dog) (Canis familiaris)

    24-99aa

    Full Length of Mature Protein

    N-terminal 6xHis-KSI-tagged

    1 mg, 100 μg, 20 μg
  • FeaturedFeatured Product
    1. Recombinant Human Cytokine receptor common subunit gamma (IL2RG) (N75Q), partial
    Item 1 of 1

    Recombinant Human Cytokine receptor common subunit gamma (IL2RG) (N75Q), partial [orb1095924]

    This product can be custom made
    FeaturedFeatured Product

    Greater than 85% as determined by SDS-PAGE.

    25.0 kDa

    Baculovirus

    Homo sapiens (Human)

    56-254aa(N75Q)

    Partial

    C-terminal 6xHis-tagged

    1 mg, 100 μg, 20 μg
  • FeaturedFeatured Product
    1. Recombinant Human C-C motif chemokine 16 (CCL16)
    Item 1 of 1

    Recombinant Human C-C motif chemokine 16 (CCL16) [orb1096113]

    This product can be custom made
    FeaturedFeatured Product

    Greater than 85% as determined by SDS-PAGE.

    13.8 kDa

    E.coli

    Homo sapiens (Human)

    24-120aa

    Full Length of Mature Protein

    N-terminal 10xHis-HA-tagged

    1 mg, 100 μg, 20 μg
  • FeaturedFeatured Product
    1. Recombinant Human C-C motif chemokine 1 (CCL1)
    Item 1 of 1

    Recombinant Human C-C motif chemokine 1 (CCL1) [orb1095951]

    This product can be custom made
    FeaturedFeatured Product

    Greater than 85% as determined by SDS-PAGE.

    11.1 kDa

    E.coli

    Homo sapiens (Human)

    24-96aa

    Full Length of Mature Protein

    N-terminal 10xHis-HA-tagged

    1 mg, 100 μg, 20 μg
  • FeaturedFeatured Product
    1. Recombinant Human C-C motif chemokine 1 (CCL1)
    Item 1 of 1

    Recombinant Human C-C motif chemokine 1 (CCL1) [orb1095952]

    This product can be custom made
    FeaturedFeatured Product

    Greater than 85% as determined by SDS-PAGE.

    12.6 kDa

    E.coli

    Homo sapiens (Human)

    24-96aa

    Full Length of Mature Protein

    N-terminal 6xHis-tagged

    1 mg, 100 μg, 20 μg

Items 241 - 250 of 2046

Show
per page

Email

[email protected]

UK Office

+44 (0)1223 859353

US Office

+1 (415) 906-5211

CN Office

+86 (27)-87663101

Distributors

biorbyt.com/distributor