You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604014 |
---|---|
Category | Proteins |
Description | Recombinant Human C-X-C motif chemokine 10 protein(CXCL10) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 12.6 kDa |
UniProt ID | P02778 |
Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 22-98aa. Protein Length: Full Length of Mature Protein |
Expression Region | 22-98aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | 10KDA interferon gamma-induced protein , Gamma-IP1 Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
> 98% as determined by SDS-PAGE and HPLC. | |
16.9 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
11.7 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
8.6 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
8.3 kDa | |
E.Coli |
Unconjugated | |
95% | |
26.6 kDa | |
Human IFN-gamma R1, His Tag (orb257557) is expressed from human 293 cells (HEK293). It contains AA Glu 18 - Gly 245 (Accession # AAH05333). |
Filter by Rating