You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330884 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PRKAA2 |
| Target | PRKAA2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PRKAA2 |
| Protein Sequence | Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |
| UniProt ID | P54646 |
| MW | 62kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti AMPK antibody, anti AMPK2 antibody, anti PRKA Read more... |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_006243 |
| Expiration Date | 12 months from date of receipt. |

Sample Type: rat hepatocyte (50 ug), Primary dilution: 1:4000, Secondary Antibody:Donkey anti-Rabbit HRP, Secondary dilution: 1:10000.

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

PRKAA2 antibody - middle region (orb330884) validated by WB using Rat Liver, Human Muscle, Rat Muscle, Mouse Muscle at 1:1000.

WB Suggested Anti-PRKAA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Mouse, Porcine, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review