Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

PRKAA2 Rabbit Polyclonal Antibody

SKU: orb330884

Description

Rabbit polyclonal antibody to PRKAA2

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PRKAA2
TargetPRKAA2
Protein SequenceSynthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP
Molecular Weight62kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti AMPK antibody, anti AMPK2 antibody, anti PRKAA antibody, anti AMPKa2 antibody

Similar Products

  • Phospho-AMPK alpha-2 (Thr172) Rabbit Polyclonal Antibody [orb99303]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • AMPK alpha 2 Rabbit Polyclonal Antibody [orb5691]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Mouse, Porcine, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-AMPK alpha 2 (Ser173) Rabbit Polyclonal Antibody [orb4413]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • AMPKα1/2 Polyclonal Antibody [orb1414692]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • AMPK2 Antibody (Center) [orb1929288]

    WB

    Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PRKAA2 Rabbit Polyclonal Antibody

Sample Type: rat hepatocyte (50 ug), Primary dilution: 1:4000, Secondary Antibody:Donkey anti-Rabbit HRP, Secondary dilution: 1:10000.

PRKAA2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

PRKAA2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

PRKAA2 Rabbit Polyclonal Antibody

PRKAA2 antibody - middle region (orb330884) validated by WB using Rat Liver, Human Muscle, Rat Muscle, Mouse Muscle at 1:1000.

PRKAA2 Rabbit Polyclonal Antibody

WB Suggested Anti-PRKAA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006243

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PRKAA2 Rabbit Polyclonal Antibody (orb330884)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry