You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587716 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PREX2 |
Target | PREX2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PREX2 |
Protein Sequence | Synthetic peptide located within the following region: ERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVH |
UniProt ID | Q70Z35 |
MW | 182kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | DEP.2, DEPDC2, P-REX2, PPP1R129 |
Note | For research use only |
Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/ml.
Sample Type: Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Biotin |