Cart summary

You have no items in your shopping cart.

PREX2 Rabbit Polyclonal Antibody (FITC)

PREX2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2085159

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2085159
CategoryAntibodies
DescriptionPREX2 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human PREX2
Protein SequenceSynthetic peptide located within the following region: ERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVH
UniProt IDQ70Z35
MW182kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesDEP.2, DEPDC2, P-REX2, PPP1R129
NoteFor research use only