PRDM9 Rabbit Polyclonal Antibody

SKU: orb324624

Description

PRDM9 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PRDM9. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human PRDM9. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRDM9
• Target: PRDM9
• Protein Sequence: Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
• Molecular Weight: 103kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti PFM6 antibody, anti MSBP3 antibody, anti PRMD9 antibody, anti ZNF899 antibody, anti MEISETZ antibody

Anti-PRDM9 antibody IHC staining of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Anti-PRDM9 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-PRDM9 Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-PRDM9 Antibody Titration: 1 ug/mL, Positive Control: 293T cells lysate.

Quick Database Links

Gene Symbol

PRDM9

UniProt

Q9NQV7

RefSeq (Protein):NP_064612