Cart summary

You have no items in your shopping cart.

PRDM9 Rabbit Polyclonal Antibody (Biotin)

PRDM9 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2132648

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2132648
CategoryAntibodies
DescriptionPRDM9 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PRDM9
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW103kDa
UniProt IDQ9NQV7
Protein SequenceSynthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
NCBINP_064612
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesPFM6, KMT8B, MSBP3, ZNF899, MEISETZ
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.