You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb581355 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PPP3CA |
| Target | PPP3CA |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3CA |
| Protein Sequence | Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL |
| UniProt ID | P63329 |
| MW | 59kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CALN, CCN1, CNA1, CALNA, DEE91, IECEE, PPP2B, ACCI Read more... |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_000935 |
| Expiration Date | 12 months from date of receipt. |

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

WB Suggested Anti-PPP3CA Antibody, Positive Control: Lane 1: 80 ug mouse brain extract, Lane 2: 80 ug rat brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody Dilution: 1:20000.

WB Suggested Anti-PPP3CA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Gallus, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Canine, Human, Porcine, Rabbit, Zebrafish | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review