You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329694 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PPP1R13L |
Target | PPP1R13L |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PPP1R13L |
Protein Sequence | Synthetic peptide located within the following region: AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRL |
UniProt ID | Q8WUF5 |
MW | 89kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti IASPP antibody, anti NKIP1 antibody, anti RAI Read more... |
Note | For research use only |
NCBI | NP_006654 |
Lanes: 1. 30 ug MiaPaca-2 cell lysate, 2. 30 ug Panc-1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody Dilution: 1:4000, Gene Name: PPP1R13L.
Sample Type: Human lung adenocarcinoma cell line A549, Primary Antibody Dilution: 1:100, Secondary Antibody: Goat anti-rabbit AlexaFluor 488, Secondary Antibody Dilution: 1:400, Color/Signal Descriptions: PPP1R13L: Green DAPI:Blue, Gene Name: PPP1R13L.
WB Suggested Anti-PPP1R13L Antibody Titration: 0.2-1 ug/mL, Positive Control: Transfected 293T.
FC, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Guinea pig, Mouse, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |