You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327313 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PPP1R12B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen for Anti-PPP1R12B antibody is: synthetic peptide directed towards the Middle region of Human MYPT2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 108 kDa |
Target | PPP1R12B |
UniProt ID | O60237 |
Protein Sequence | Synthetic peptide located within the following region: FNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSS |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MYPT2 antibody, anti PP1bp55 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 721_B Whole Cell, Antibody Dilution: 1.0 ug/mL.