Cart summary

You have no items in your shopping cart.

PPP1R12B Rabbit Polyclonal Antibody (FITC)

PPP1R12B Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2082597

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2082597
CategoryAntibodies
DescriptionPPP1R12B Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen for Anti-PPP1R12B antibody is: synthetic peptide directed towards the Middle region of Human MYPT2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW108 kDa
UniProt IDO60237
Protein SequenceSynthetic peptide located within the following region: FNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSS
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMYPT2, PP1bp55
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.