Porcn Rabbit Polyclonal Antibody

• Catalog Number: orb580852
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Porcn
• Target: Porcn
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: VAMKAVSLGFDLDRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQA
• UniProt ID: Q9JJJ7
• MW: 52 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: p, Mp, Ppn, Mg61, porc, Mporc, mMg61, AW045557, DX
• Research Area: Molecular Biology
• Note: For research use only
• NCBI: NP_058609

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

WB Suggested Anti-PORCN Antibody, Positive Control: Lane 1: 50 ug PORCN-KO HT1080 (microsomes), Lane 2: 50 ug HT1080 (microsomes), Lane 3: 50 ug PORCN transfected HT1080 (microsomes), Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-Porcn Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Thymus.