You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580852 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Porcn |
Target | Porcn |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: VAMKAVSLGFDLDRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQA |
UniProt ID | Q9JJJ7 |
MW | 52 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | p, Mp, Ppn, Mg61, porc, Mporc, mMg61, AW045557, DX Read more... |
Note | For research use only |
NCBI | NP_058609 |
25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.
WB Suggested Anti-PORCN Antibody, Positive Control: Lane 1: 50 ug PORCN-KO HT1080 (microsomes), Lane 2: 50 ug HT1080 (microsomes), Lane 3: 50 ug PORCN transfected HT1080 (microsomes), Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:10000.
WB Suggested Anti-Porcn Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Thymus.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |