PORCN Rabbit Polyclonal Antibody

• Catalog Number: orb580851
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PORCN
• Target: PORCN
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PORCN
• Protein Sequence: Synthetic peptide located within the following region: ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF
• UniProt ID: Q9H237
• MW: 52 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PPN, DHOF, FODH, MG61, PORC
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_073736

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Sample Type: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.

Positive control (+): Human lung (LU), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

Immunohistochemistry, Sample type: Mouse Uterus, - primary antibody dilution 1 in 300, - secondary antibody dilution 1 in 1000.

WB Suggested Anti-PORCN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.