You have no items in your shopping cart.
Cart summary
Porcine IL-6 protein
Catalog Number: orb1216317
| Catalog Number | orb1216317 |
|---|---|
| Category | Proteins |
| Description | The Swine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-6 Specifications: (Molecular Weight: 20.9 kDa) (Amino Acid Sequence: GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183)) (Gene ID: 399500). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 20.9 kDa |
| Target | IL-6 |
| Entrez | 399500 |
| Protein Sequence | GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183) |
| Protein Length | 183 |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
IL 6 Porcine Protein [orb2024833]
Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
2 μgPorcine IL-6 protein [orb633361]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
20.8 KDa
E.Coli
100 μg, 1 mg, 200 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars