You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330392 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PODXL |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PODXL |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | PODXL |
UniProt ID | A6NHX8 |
Protein Sequence | Synthetic peptide located within the following region: PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ |
NCBI | NP_001018121 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti Gp200 antibody, anti MGC138240 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/mL using anti-PODXL antibody (orb330392).
WB Suggested Anti-PODXL Antibody Titration: 0.5 ug/mL, Positive Control: Jurkat cell lysate.
FC, IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
BF555 |
WB | |
Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |