PODXL Rabbit Polyclonal Antibody

• Catalog Number: orb330392
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PODXL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PODXL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: PODXL
• UniProt ID: A6NHX8
• Protein Sequence: Synthetic peptide located within the following region: PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ
• NCBI: NP_001018121
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Gp200 antibody, anti MGC138240 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/mL using anti-PODXL antibody (orb330392).

WB Suggested Anti-PODXL Antibody Titration: 0.5 ug/mL, Positive Control: Jurkat cell lysate.